FABP1 Antikörper (N-Term)

Produktnummer ABIN632091

Produktdetails anti-FABP1 Antikörper

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FABP1 antibody was raised against the N terminal of FABP1

Aufreinigung: Affinity purified

Immunogen: FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FABP1 Blocking Peptide, catalog no. 33R-6421, is also available for use as a blocking control in assays to test for specificity of this FABP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FABP1

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Andere Bezeichnung: FABP1 (FABP1 Produkte)

Hintergrund: FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha