MDP1 Antikörper (N-Term)

Produktnummer ABIN632094

Produktdetails anti-MDP1 Antikörper

Target: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MDP1 antibody was raised against the N terminal Of Mdp-1

Aufreinigung: Affinity purified

Immunogen: MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MDP1 Blocking Peptide, catalog no. 33R-5731, is also available for use as a blocking control in assays to test for specificity of this MDP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDP-1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MDP1

Target: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Andere Bezeichnung: MDP1 (MDP1 Produkte)

Synonyme: MGC133592 antikoerper, FN6PASE antikoerper, MDP-1 antikoerper, 1810034K20Rik antikoerper, AI035604 antikoerper, Mdp-1 antikoerper, RGD1311147 antikoerper, magnesium-dependent phosphatase 1 antikoerper, magnesium dependent phosphatase 1 antikoerper, Magnesium-dependent phosphatase 1 antikoerper, LOC480264 antikoerper, MDP1 antikoerper, Mdp1 antikoerper, mgdp1 antikoerper

Hintergrund: MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Molekulargewicht: 20 kDa (MW of target protein)