PPM1J Antikörper

Produktnummer ABIN632095

Produktdetails anti-PPM1J Antikörper

Target: PPM1J (Protein Phosphatase 1J (PPM1J))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPM1J Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPM1 J antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPM1J Blocking Peptide, catalog no. 33R-9070, is also available for use as a blocking control in assays to test for specificity of this PPM1J antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPM1J

Target: PPM1J (Protein Phosphatase 1J (PPM1J))

Andere Bezeichnung: PPM1J (PPM1J Produkte)

Synonyme: 2310008J22Rik antikoerper, PP2Czeta antikoerper, Ppp2cz antikoerper, PP2CZ antikoerper, PPP2CZ antikoerper, protein phosphatase 1J antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1J antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1J antikoerper, Ppm1j antikoerper, PPM1J antikoerper

Hintergrund: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.

Molekulargewicht: 55 kDa (MW of target protein)