Septin 9 Antikörper (Middle Region)
-
- Target Alle Septin 9 (SEPT9) Antikörper anzeigen
- Septin 9 (SEPT9)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Septin 9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Septin 9 antibody was raised against the middle region of SEPT9
- Aufreinigung
- Affinity purified
- Immunogen
- Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL
- Top Product
- Discover our top product SEPT9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Septin 9 Blocking Peptide, catalog no. 33R-9702, is also available for use as a blocking control in assays to test for specificity of this Septin 9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Septin 9 (SEPT9)
- Andere Bezeichnung
- Septin 9 (SEPT9 Produkte)
- Synonyme
- SEPT9 antikoerper, msf antikoerper, msf1 antikoerper, napb antikoerper, sint1 antikoerper, pnutl4 antikoerper, septd1 antikoerper, af17q25 antikoerper, septin-9 antikoerper, AF17q25 antikoerper, MSF antikoerper, MSF1 antikoerper, NAPB antikoerper, PNUTL4 antikoerper, SINT1 antikoerper, SeptD1 antikoerper, Msf antikoerper, Sint1 antikoerper, Eseptin antikoerper, Slpa antikoerper, cb999 antikoerper, fb02h06 antikoerper, sept9 antikoerper, wu:fb02h06 antikoerper, septin 9 antikoerper, septin-9 antikoerper, septin 9 S homeolog antikoerper, septin 9a antikoerper, SEPT9 antikoerper, sept9 antikoerper, LOC100605286 antikoerper, sept9.S antikoerper, Sept9 antikoerper, sept9a antikoerper
- Hintergrund
- This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.
- Molekulargewicht
- 46 kDa (MW of target protein)
-