ASXL2 Antikörper
-
- Target Alle ASXL2 Antikörper anzeigen
- ASXL2 (Additional Sex Combs Like 2 (ASXL2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASXL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS
- Top Product
- Discover our top product ASXL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASXL2 Blocking Peptide, catalog no. 33R-2337, is also available for use as a blocking control in assays to test for specificity of this ASXL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASXL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASXL2 (Additional Sex Combs Like 2 (ASXL2))
- Andere Bezeichnung
- ASXL2 (ASXL2 Produkte)
- Synonyme
- asxh2 antikoerper, ASXH2 antikoerper, 4930556B16Rik antikoerper, mKIAA1685 antikoerper, additional sex combs like 2, transcriptional regulator antikoerper, additional sex combs like 2 (Drosophila) antikoerper, Asxl2 antikoerper, ASXL2 antikoerper, asxl2 antikoerper
- Hintergrund
- ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing.
- Molekulargewicht
- 154 kDa (MW of target protein)
- Pathways
- Positive Regulation of fat Cell Differentiation
-