Acylglycerol Kinase Antikörper (N-Term)

Produktnummer ABIN632105

Produktdetails anti-Acylglycerol Kinase Antikörper

Target: Acylglycerol Kinase (AGK)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Acylglycerol Kinase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AGK antibody was raised against the N terminal of AGK

Aufreinigung: Affinity purified

Immunogen: AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGK Blocking Peptide, catalog no. 33R-4482, is also available for use as a blocking control in assays to test for specificity of this AGK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Acylglycerol Kinase

Target: Acylglycerol Kinase (AGK)

Andere Bezeichnung: AGK (AGK Produkte)

Synonyme: mulk antikoerper, CATC5 antikoerper, CTRCT38 antikoerper, MTDPS10 antikoerper, MULK antikoerper, 2610037M15Rik antikoerper, 6720408I04Rik antikoerper, AI465370 antikoerper, Mulk antikoerper, RGD1562046 antikoerper, fi38e09 antikoerper, wu:fi38e09 antikoerper, zgc:55462 antikoerper, acylglycerol kinase antikoerper, acylglycerol kinase S homeolog antikoerper, AGK antikoerper, agk antikoerper, LOC100165096 antikoerper, Agk antikoerper, agk.S antikoerper

Hintergrund: AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

Molekulargewicht: 47 kDa (MW of target protein)