EPRS Antikörper (Middle Region)
-
- Target Alle EPRS Antikörper anzeigen
- EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPRS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EPRS antibody was raised against the middle region of EPRS
- Aufreinigung
- Affinity purified
- Immunogen
- EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL
- Top Product
- Discover our top product EPRS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EPRS Blocking Peptide, catalog no. 33R-3367, is also available for use as a blocking control in assays to test for specificity of this EPRS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPRS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))
- Andere Bezeichnung
- EPRS (EPRS Produkte)
- Synonyme
- EARS antikoerper, GLUPRORS antikoerper, PARS antikoerper, QARS antikoerper, QPRS antikoerper, wu:fb38d08 antikoerper, wu:ft34d10 antikoerper, 2410081F06Rik antikoerper, 3010002K18Rik antikoerper, C79379 antikoerper, Qprs antikoerper, glutamyl-prolyl-tRNA synthetase antikoerper, glutamyl-prolyl-tRNA synthetase S homeolog antikoerper, EPRS antikoerper, eprs antikoerper, eprs.S antikoerper, Eprs antikoerper
- Hintergrund
- The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
- Molekulargewicht
- 170 kDa (MW of target protein)
-