THG1L Antikörper
-
- Target Alle THG1L Antikörper anzeigen
- THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser THG1L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- THG1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY
- Top Product
- Discover our top product THG1L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
THG1L Blocking Peptide, catalog no. 33R-1871, is also available for use as a blocking control in assays to test for specificity of this THG1L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THG0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))
- Andere Bezeichnung
- THG1L (THG1L Produkte)
- Synonyme
- ICF45 antikoerper, IHG-1 antikoerper, 1700121M19Rik antikoerper, 5730409G07Rik antikoerper, AA387658 antikoerper, tRNA-histidine guanylyltransferase 1 like antikoerper, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) antikoerper, tRNA-histidine guanylyltransferase 1-like antikoerper, THG1L antikoerper, Thg1l antikoerper
- Hintergrund
- THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.
- Molekulargewicht
- 35 kDa (MW of target protein)
-