FAM84A Antikörper (N-Term)
-
- Target Alle FAM84A Antikörper anzeigen
- FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM84A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM84 A antibody was raised against the N terminal of FAM84
- Aufreinigung
- Affinity purified
- Immunogen
- FAM84 A antibody was raised using the N terminal of FAM84 corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD
- Top Product
- Discover our top product FAM84A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM84A Blocking Peptide, catalog no. 33R-3455, is also available for use as a blocking control in assays to test for specificity of this FAM84A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))
- Andere Bezeichnung
- FAM84A (FAM84A Produkte)
- Synonyme
- 2310003N02Rik antikoerper, 4731402F03Rik antikoerper, AW125753 antikoerper, Nse1 antikoerper, NSE1 antikoerper, PP11517 antikoerper, RGD1305779 antikoerper, zgc:63724 antikoerper, family with sequence similarity 84, member A antikoerper, family with sequence similarity 84 member A antikoerper, Fam84a antikoerper, FAM84A antikoerper, fam84a antikoerper
- Hintergrund
- FAM84A belongs to the FAM84 family. Up-regulation of FAM84A may play a critical role in progression of colon cancer.
- Molekulargewicht
- 32 kDa (MW of target protein)
-