LIX1L Antikörper
-
- Target Alle LIX1L Produkte
- LIX1L (Lix1 Homolog Like (LIX1L))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LIX1L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LIX1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN
-
anti-Lix1 Homolog Like (LIX1L) (AA 160-189) antibody
LIX1L Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB32034 unconjugated
anti-Lix1 Homolog Like (LIX1L) (AA 71-120) antibodyLIX1L Reaktivität: Human, Maus, Rind (Kuh), Hund, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio), Schwein, Affe, Fledermaus, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Lix1 Homolog Like (LIX1L) (N-Term) antibodyLIX1L Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Lix1 Homolog Like (LIX1L) (N-Term) antibodyLIX1L Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Kaninchen, Schwein, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Lix1 Homolog Like (LIX1L) (N-Term) antibodyLIX1L Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Lix1 Homolog Like (LIX1L) (AA 159-189), (Middle Region) antibodyLIX1L Reaktivität: Human, Maus WB, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LIX1L Blocking Peptide, catalog no. 33R-1225, is also available for use as a blocking control in assays to test for specificity of this LIX1L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIX1L (Lix1 Homolog Like (LIX1L))
- Andere Bezeichnung
- LIX1L (LIX1L Produkte)
- Synonyme
- si:ch211-210h11.10 antikoerper, D130027M04Rik antikoerper, limb and CNS expressed 1 like antikoerper, Lix1-like antikoerper, lix1l antikoerper, LIX1L antikoerper, Lix1l antikoerper
- Hintergrund
- LIX1L may function as a modulator of fat signaling.
- Molekulargewicht
- 36 kDa (MW of target protein)
-
