WDTC1 Antikörper (N-Term)
-
- Target Alle WDTC1 (Wdtc1) Produkte
- WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WDTC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDTC1 antibody was raised against the N terminal of WDTC1
- Aufreinigung
- Affinity purified
- Immunogen
- WDTC1 antibody was raised using the N terminal of WDTC1 corresponding to a region with amino acids PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDTC1 Blocking Peptide, catalog no. 33R-7230, is also available for use as a blocking control in assays to test for specificity of this WDTC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDTC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))
- Andere Bezeichnung
- WDTC1 (Wdtc1 Produkte)
- Hintergrund
- WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.
- Molekulargewicht
- 76 kDa (MW of target protein)
-