WDTC1 Antikörper (N-Term)

Produktnummer ABIN632114

Produktdetails anti-WDTC1 Antikörper

Target: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDTC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDTC1 antibody was raised against the N terminal of WDTC1

Aufreinigung: Affinity purified

Immunogen: WDTC1 antibody was raised using the N terminal of WDTC1 corresponding to a region with amino acids PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDTC1 Blocking Peptide, catalog no. 33R-7230, is also available for use as a blocking control in assays to test for specificity of this WDTC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDTC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDTC1

Target: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Andere Bezeichnung: WDTC1 (Wdtc1 Produkte)

Synonyme: fc31b01 antikoerper, wu:fc31b01 antikoerper, zgc:194983 antikoerper, ADP antikoerper, DCAF9 antikoerper, Gm695 antikoerper, adipose antikoerper, adp antikoerper, WD and tetratricopeptide repeats 1 antikoerper, WD and tetratricopeptide repeats 1 L homeolog antikoerper, WDTC1 antikoerper, wdtc1 antikoerper, wdtc1.L antikoerper, Wdtc1 antikoerper

Hintergrund: WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

Molekulargewicht: 76 kDa (MW of target protein)