CCDC69 Antikörper (Middle Region)
-
- Target Alle CCDC69 Antikörper anzeigen
- CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCDC69 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CCDC69 antibody was raised against the middle region of CCDC69
- Aufreinigung
- Affinity purified
- Immunogen
- CCDC69 antibody was raised using the middle region of CCDC69 corresponding to a region with amino acids TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT
- Top Product
- Discover our top product CCDC69 Primärantikörper
-
anti-Coiled-Coil Domain Containing 69 (CCDC69) (AA 1-296) antibody
CCDC69 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4G6 unconjugated
anti-Coiled-Coil Domain Containing 69 (CCDC69) (AA 41-140) antibodyCCDC69 Reaktivität: Human ELISA, IF (p), IF (cc), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Coiled-Coil Domain Containing 69 (CCDC69) (C-Term) antibodyCCDC69 Reaktivität: Human, Rind (Kuh), Meerschweinchen, Affe, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Coiled-Coil Domain Containing 69 (CCDC69) (Middle Region) antibodyCCDC69 Reaktivität: Human, Ratte, Rind (Kuh), Meerschweinchen, Schwein, Hund, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCDC69 Blocking Peptide, catalog no. 33R-9255, is also available for use as a blocking control in assays to test for specificity of this CCDC69 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC69 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))
- Andere Bezeichnung
- CCDC69 (CCDC69 Produkte)
- Synonyme
- ccdc69 antikoerper, MGC83627 antikoerper, MGC147153 antikoerper, 2210021E03Rik antikoerper, D11Ertd461e antikoerper, RGD1562251 antikoerper, coiled-coil domain containing 69 antikoerper, coiled-coil domain containing 69 S homeolog antikoerper, coiled-coil domain containing 69 L homeolog antikoerper, CCDC69 antikoerper, ccdc69.S antikoerper, ccdc69 antikoerper, ccdc69.L antikoerper, Ccdc69 antikoerper
- Hintergrund
- The function of CCDC69 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 35 kDa (MW of target protein)
-
