PGM2L1 Antikörper (N-Term)

Produktnummer ABIN632120

Produktdetails anti-PGM2L1 Antikörper

Target: PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGM2L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PGM2 L1 antibody was raised against the N terminal of PGM2 1

Aufreinigung: Affinity purified

Immunogen: PGM2 L1 antibody was raised using the N terminal of PGM2 1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGM2L1 Blocking Peptide, catalog no. 33R-4321, is also available for use as a blocking control in assays to test for specificity of this PGM2L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGM2L1

Target: PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))

Andere Bezeichnung: PGM2L1 (PGM2L1 Produkte)

Synonyme: 4931406N15Rik antikoerper, AI553438 antikoerper, BM32A antikoerper, im:7140576 antikoerper, zgc:198285 antikoerper, pgm2l1 antikoerper, phosphoglucomutase 2-like 1 antikoerper, phosphoglucomutase 2 like 1 antikoerper, phosphoglucomutase 2-like 1 L homeolog antikoerper, Pgm2l1 antikoerper, PGM2L1 antikoerper, pgm2l1 antikoerper, pgm2l1.L antikoerper

Hintergrund: PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.

Molekulargewicht: 70 kDa (MW of target protein)