PGM2L1 Antikörper (N-Term)
-
- Target Alle PGM2L1 Antikörper anzeigen
- PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PGM2L1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PGM2 L1 antibody was raised against the N terminal of PGM2 1
- Aufreinigung
- Affinity purified
- Immunogen
- PGM2 L1 antibody was raised using the N terminal of PGM2 1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK
- Top Product
- Discover our top product PGM2L1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGM2L1 Blocking Peptide, catalog no. 33R-4321, is also available for use as a blocking control in assays to test for specificity of this PGM2L1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))
- Andere Bezeichnung
- PGM2L1 (PGM2L1 Produkte)
- Hintergrund
- PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.
- Molekulargewicht
- 70 kDa (MW of target protein)
-