CCDC138 Antikörper (N-Term)

Produktnummer ABIN632125

Produktdetails anti-CCDC138 Antikörper

Target: CCDC138 (Coiled-Coil Domain Containing 138 (CCDC138))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC138 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC138 antibody was raised against the N terminal of CCDC138

Aufreinigung: Affinity purified

Immunogen: CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC138 Blocking Peptide, catalog no. 33R-2646, is also available for use as a blocking control in assays to test for specificity of this CCDC138 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC138 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC138

Target: CCDC138 (Coiled-Coil Domain Containing 138 (CCDC138))

Andere Bezeichnung: CCDC138 (CCDC138 Produkte)

Synonyme: 6230424H07Rik antikoerper, BC042726 antikoerper, MGC115290 antikoerper, RGD1566050 antikoerper, coiled-coil domain containing 138 antikoerper, coiled-coil domain containing 138 L homeolog antikoerper, Ccdc138 antikoerper, CCDC138 antikoerper, ccdc138.L antikoerper, ccdc138 antikoerper

Hintergrund: The function of the CCDC138 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 76 kDa (MW of target protein)

Pathways: BCR Signaling