ANKMY2 Antikörper (N-Term)

Produktnummer ABIN632127

Produktdetails anti-ANKMY2 Antikörper

Target: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKMY2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANKMY2 antibody was raised against the N terminal of ANKMY2

Aufreinigung: Affinity purified

Immunogen: ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKMY2 Blocking Peptide, catalog no. 33R-2226, is also available for use as a blocking control in assays to test for specificity of this ANKMY2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKMY2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKMY2

Target: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Andere Bezeichnung: ANKMY2 (ANKMY2 Produkte)

Synonyme: ZMYND20 antikoerper, AI035571 antikoerper, Gna14 antikoerper, ankmy2 antikoerper, si:dkeyp-25a3.5 antikoerper, fi46e08 antikoerper, wu:fi46e08 antikoerper, zgc:55491 antikoerper, ankyrin repeat and MYND domain containing 2 antikoerper, ankyrin repeat and MYND domain containing 2b antikoerper, ankyrin repeat and MYND domain containing 2a antikoerper, ANKMY2 antikoerper, Ankmy2 antikoerper, ankmy2b antikoerper, ankmy2a antikoerper

Hintergrund: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 49 kDa (MW of target protein)