ACTR3B Antikörper
-
- Target Alle ACTR3B Antikörper anzeigen
- ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTR3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR
- Top Product
- Discover our top product ACTR3B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACTR3B Blocking Peptide, catalog no. 33R-5669, is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))
- Andere Bezeichnung
- ACTR3B (ACTR3B Produkte)
- Synonyme
- RGD1565759 antikoerper, ARP11 antikoerper, ARP3BETA antikoerper, 9630005C02 antikoerper, AW047569 antikoerper, Arp3b antikoerper, Arp3beta antikoerper, ARP3 actin related protein 3 homolog B antikoerper, ARP3 actin-related protein 3B antikoerper, Actr3b antikoerper, ACTR3B antikoerper
- Hintergrund
- ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-