VGLL3 Antikörper
-
- Target Alle VGLL3 Antikörper anzeigen
- VGLL3 (Vestigial Like 3 (VGLL3))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VGLL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY
- Top Product
- Discover our top product VGLL3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VGLL3 Blocking Peptide, catalog no. 33R-1663, is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGLL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VGLL3 (Vestigial Like 3 (VGLL3))
- Andere Bezeichnung
- VGLL3 (VGLL3 Produkte)
- Synonyme
- RGD1560030 antikoerper, VGL-3 antikoerper, VGL3 antikoerper, 1700110N18Rik antikoerper, 4832416J22 antikoerper, C80713 antikoerper, Vgl-3 antikoerper, Vito-2 antikoerper, vestigial-like family member 3 antikoerper, vestigial like family member 3 antikoerper, Vgll3 antikoerper, VGLL3 antikoerper
- Hintergrund
- VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.
- Molekulargewicht
- 36 kDa (MW of target protein)
-