CCT8 Antikörper
-
- Target Alle CCT8 Antikörper anzeigen
- CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCT8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
- Top Product
- Discover our top product CCT8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCT8 Blocking Peptide, catalog no. 33R-2076, is also available for use as a blocking control in assays to test for specificity of this CCT8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))
- Andere Bezeichnung
- CCT8 (CCT8 Produkte)
- Hintergrund
- As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
- Molekulargewicht
- 59 kDa (MW of target protein)
-