CCT8 Antikörper

Produktnummer ABIN632135

Produktdetails anti-CCT8 Antikörper

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCT8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCT8 Blocking Peptide, catalog no. 33R-2076, is also available for use as a blocking control in assays to test for specificity of this CCT8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCT8

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Andere Bezeichnung: CCT8 (CCT8 Produkte)

Synonyme: CCT8 antikoerper, DKFZp469C2223 antikoerper, MGC89698 antikoerper, C21orf112 antikoerper, Cctq antikoerper, D21S246 antikoerper, PRED71 antikoerper, AI132397 antikoerper, Tcpq antikoerper, fa22h09 antikoerper, wu:fa22h09 antikoerper, zgc:56059 antikoerper, chaperonin containing TCP1 subunit 8 antikoerper, chaperonin containing TCP1, subunit 8 (theta) antikoerper, chaperonin containing Tcp1, subunit 8 (theta) antikoerper, chaperonin containing TCP1 subunit 8 L homeolog antikoerper, Chaperonin Containing TCP-1 antikoerper, CCT8 antikoerper, cct8 antikoerper, Cct8 antikoerper, cct8.L antikoerper, cct-8 antikoerper

Hintergrund: As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Molekulargewicht: 59 kDa (MW of target protein)