SFRP2 Antikörper (Middle Region)
-
- Target Alle SFRP2 Antikörper anzeigen
- SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFRP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFRP2 antibody was raised against the middle region of SFRP2
- Aufreinigung
- Affinity purified
- Immunogen
- SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
- Top Product
- Discover our top product SFRP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRP2 Blocking Peptide, catalog no. 33R-2142, is also available for use as a blocking control in assays to test for specificity of this SFRP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))
- Andere Bezeichnung
- SFRP2 (SFRP2 Produkte)
- Synonyme
- frp-2 antikoerper, sarp1 antikoerper, sdf-5 antikoerper, sfrp-2 antikoerper, SFRP2 antikoerper, sfrp2 antikoerper, FRP-2 antikoerper, SARP1 antikoerper, SDF-5 antikoerper, AI851596 antikoerper, Sdf5 antikoerper, hm:zeh0225 antikoerper, zeh0225 antikoerper, zgc:153618 antikoerper, SFRP-2 antikoerper, secreted frizzled-related protein 2 antikoerper, secreted frizzled related protein 2 antikoerper, secreted frizzled-related protein 2 S homeolog antikoerper, secreted frizzled-related protein antikoerper, sfrp2 antikoerper, sfrp2 antikoerper, SFRP2 antikoerper, sfrp2.S antikoerper, LOAG_01461 antikoerper, Sfrp2 antikoerper
- Hintergrund
- SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Tube Formation, Positive Regulation of Endopeptidase Activity, Negative Regulation of intrinsic apoptotic Signaling, Positive Regulation of fat Cell Differentiation
-