PRMT7 Antikörper (N-Term)

Produktnummer ABIN632137

Produktdetails anti-PRMT7 Antikörper

Target: PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRMT7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRMT7 antibody was raised against the N terminal of PRMT7

Aufreinigung: Affinity purified

Immunogen: PRMT7 antibody was raised using the N terminal of PRMT7 corresponding to a region with amino acids MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRMT7 Blocking Peptide, catalog no. 33R-6141, is also available for use as a blocking control in assays to test for specificity of this PRMT7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRMT7

Target: PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))

Andere Bezeichnung: PRMT7 (PRMT7 Produkte)

Hintergrund: Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing.

Molekulargewicht: 78 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization