CCDC63 Antikörper (Middle Region)

Produktnummer ABIN632141

Produktdetails anti-CCDC63 Antikörper

Target: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC63 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC63 antibody was raised against the middle region of CCDC63

Aufreinigung: Affinity purified

Immunogen: CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC63 Blocking Peptide, catalog no. 33R-2679, is also available for use as a blocking control in assays to test for specificity of this CCDC63 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC63 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC63

Target: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Andere Bezeichnung: CCDC63 (CCDC63 Produkte)

Synonyme: ODA5 antikoerper, 4921511C16Rik antikoerper, coiled-coil domain containing 63 antikoerper, CCDC63 antikoerper, Ccdc63 antikoerper

Hintergrund: The function of CCDC63 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 66 kDa (MW of target protein)