EPS8-Like 1 Antikörper (Middle Region)
-
- Target Alle EPS8-Like 1 (EPS8L1) Antikörper anzeigen
- EPS8-Like 1 (EPS8L1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPS8-Like 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EPS8 L1 antibody was raised against the middle region of EPS8 1
- Aufreinigung
- Affinity purified
- Immunogen
- EPS8 L1 antibody was raised using the middle region of EPS8 1 corresponding to a region with amino acids LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG
- Top Product
- Discover our top product EPS8L1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EPS8L1 Blocking Peptide, catalog no. 33R-5318, is also available for use as a blocking control in assays to test for specificity of this EPS8L1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPS0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPS8-Like 1 (EPS8L1)
- Andere Bezeichnung
- EPS8L1 (EPS8L1 Produkte)
- Synonyme
- EPS8L1 antikoerper, drc3 antikoerper, eps8r1 antikoerper, DRC3 antikoerper, EPS8R1 antikoerper, 2310051G19Rik antikoerper, 4632407K17Rik antikoerper, AW060268 antikoerper, zgc:113583 antikoerper, EPS8 like 1 antikoerper, EPS8-like 1 antikoerper, EPS8 like 1 L homeolog antikoerper, eps8-like1 antikoerper, EPS8L1 antikoerper, eps8l1 antikoerper, eps8l1.L antikoerper, Eps8l1 antikoerper
- Hintergrund
- EPS8L1 a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown.
- Molekulargewicht
- 66 kDa (MW of target protein)
-