ITPK1 Antikörper (N-Term)

Produktnummer ABIN632148

Produktdetails anti-ITPK1 Antikörper

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITPK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ITPK1 antibody was raised against the N terminal of ITPK1

Aufreinigung: Affinity purified

Immunogen: ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITPK1 Blocking Peptide, catalog no. 33R-5984, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITPK1

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Andere Bezeichnung: ITPK1 (ITPK1 Produkte)

Synonyme: ITRPK1 antikoerper, BC031182 antikoerper, wu:fj15d08 antikoerper, zgc:56075 antikoerper, inositol-tetrakisphosphate 1-kinase antikoerper, inositol 1,3,4-triphosphate 5/6 kinase antikoerper, inositol-tetrakisphosphate 1-kinase L homeolog antikoerper, inositol-tetrakisphosphate 1-kinase a antikoerper, ITPK1 antikoerper, Itpk1 antikoerper, itpk1.L antikoerper, itpk1a antikoerper

Hintergrund: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.

Molekulargewicht: 45 kDa (MW of target protein)