C19orf54 Antikörper (N-Term)

Produktnummer ABIN632149

Produktdetails anti-C19orf54 Antikörper

Target: C19orf54 (Chromosome 19 Open Reading Frame 54 (C19orf54))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C19 ORF54 antibody was raised against the N terminal Of C19 rf54

Aufreinigung: Affinity purified

Immunogen: C19 ORF54 antibody was raised using the N terminal Of C19 rf54 corresponding to a region with amino acids MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF54 Blocking Peptide, catalog no. 33R-6564, is also available for use as a blocking control in assays to test for specificity of this C19ORF54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf54

Target: C19orf54 (Chromosome 19 Open Reading Frame 54 (C19orf54))

Andere Bezeichnung: C19ORF54 (C19orf54 Produkte)

Synonyme: C19H19orf54 antikoerper, chromosome 19 open reading frame 54 antikoerper, chromosome 19 open reading frame, human C19orf54 antikoerper, C19orf54 antikoerper, C19H19orf54 antikoerper, c19orf54 antikoerper

Hintergrund: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 23 kDa (MW of target protein)