ERP44 Antikörper
-
- Target Alle ERP44 Antikörper anzeigen
- ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERP44 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
- Top Product
- Discover our top product ERP44 Primärantikörper
-
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody
ERP44 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibodyERP44 Reaktivität: Human WB, ELISA, IHC (p), IP Wirt: Maus Monoclonal 3C7 unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (Internal Region) antibodyERP44 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Pferd, Affe, Meerschweinchen, Schwein, Fledermaus, Huhn, Xenopus laevis IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-407) antibodyERP44 Reaktivität: Human WB, IHC, ELISA, IHC (p), IP Wirt: Maus Monoclonal 3C7 unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) antibodyERP44 Reaktivität: Human, Maus WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) antibodyERP44 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 57-406) antibodyERP44 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (Internal Region) antibodyVerified ERP44 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (C-Term) antibodyERP44 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Schwein, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (C-Term) antibodyERP44 Reaktivität: Human IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TXNDC4 Blocking Peptide, catalog no. 33R-5025, is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))
- Andere Bezeichnung
- TXNDC4 (ERP44 Produkte)
- Synonyme
- PDIA10 antikoerper, TXNDC4 antikoerper, 1110001E24Rik antikoerper, AI849526 antikoerper, AL033348 antikoerper, Txndc4 antikoerper, BWK4 antikoerper, txndc4 antikoerper, zgc:77883 antikoerper, endoplasmic reticulum protein 44 antikoerper, ERP44 antikoerper, Erp44 antikoerper, erp44 antikoerper
- Hintergrund
- TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis, SARS-CoV-2 Protein Interaktom
-
