IFIT3 Antikörper (N-Term)
-
- Target Alle IFIT3 Antikörper anzeigen
- IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IFIT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- IFIT3 antibody was raised against the N terminal of IFIT3
- Aufreinigung
- Affinity purified
- Immunogen
- IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
- Top Product
- Discover our top product IFIT3 Primärantikörper
-
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (AA 1-490) antibody
IFIT3 Reaktivität: Human WB, ELISA, IHC, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) antibodyIFIT3 Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (N-Term) antibodyIFIT3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Schwein, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) antibodyIFIT3 Reaktivität: Human, Maus, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (AA 1-490) antibodyIFIT3 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (AA 1-490) antibodyIFIT3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (AA 128-331) antibodyIFIT3 Reaktivität: Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (AA 51-100) antibodyIFIT3 Reaktivität: Human, Rind (Kuh) WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) antibodyIFIT3 Reaktivität: Human WB, IHC, IF, FACS Wirt: Maus Monoclonal 1G1 unconjugated
anti-Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) antibodyIFIT3 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IFIT3 Blocking Peptide, catalog no. 33R-1568, is also available for use as a blocking control in assays to test for specificity of this IFIT3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))
- Andere Bezeichnung
- IFIT3 (IFIT3 Produkte)
- Synonyme
- DKFZp469G2233 antikoerper, CIG-49 antikoerper, GARG-49 antikoerper, IFI60 antikoerper, IFIT4 antikoerper, IRG2 antikoerper, ISG60 antikoerper, P60 antikoerper, RIG-G antikoerper, Ifi49 antikoerper, P49 antikoerper, IFIT-3 antikoerper, interferon induced protein with tetratricopeptide repeats 3 antikoerper, interferon-induced protein with tetratricopeptide repeats 3 antikoerper, IFIT3 antikoerper, Ifit3 antikoerper
- Hintergrund
- IFIT3 is involved in protein binding.
- Molekulargewicht
- 56 kDa (MW of target protein)
-
