C14orf174 Antikörper (N-Term)

Produktnummer ABIN632166

Produktdetails anti-C14orf174 Antikörper

Target: C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C14orf174 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF174 antibody was raised against the N terminal Of C14 rf174

Aufreinigung: Affinity purified

Immunogen: C14 ORF174 antibody was raised using the N terminal Of C14 rf174 corresponding to a region with amino acids FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF174 Blocking Peptide, catalog no. 33R-3024, is also available for use as a blocking control in assays to test for specificity of this C14ORF174 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF174 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C14orf174

Target: C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))

Andere Bezeichnung: C14ORF174 (C14orf174 Produkte)

Synonyme: C14orf174 antikoerper, FAM15A antikoerper, Gm263 antikoerper, sterile alpha motif domain containing 15 antikoerper, SAMD15 antikoerper, Samd15 antikoerper

Hintergrund: C14orf174 contains 1 SAM (sterile alpha motif) domain. The exact functions of C14orf174 remain unknown.

Molekulargewicht: 77 kDa (MW of target protein)