LIX1 Antikörper

Produktnummer ABIN632169

Produktdetails anti-LIX1 Antikörper

Target: LIX1 (Lix1 Homolog (LIX1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LIX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIX1 Blocking Peptide, catalog no. 33R-9181, is also available for use as a blocking control in assays to test for specificity of this LIX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIX1

Target: LIX1 (Lix1 Homolog (LIX1))

Andere Bezeichnung: LIX1 (LIX1 Produkte)

Synonyme: 5730466L18Rik antikoerper, si:ch211-236k19.8 antikoerper, C5orf11 antikoerper, limb and CNS expressed 1 antikoerper, Lix1 antikoerper, LIX1 antikoerper, lix1 antikoerper

Hintergrund: The function of LIX1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 32 kDa (MW of target protein)