LIX1 Antikörper
-
- Target Alle LIX1 Antikörper anzeigen
- LIX1 (Lix1 Homolog (LIX1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LIX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LIX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
- Top Product
- Discover our top product LIX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LIX1 Blocking Peptide, catalog no. 33R-9181, is also available for use as a blocking control in assays to test for specificity of this LIX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIX1 (Lix1 Homolog (LIX1))
- Andere Bezeichnung
- LIX1 (LIX1 Produkte)
- Synonyme
- 5730466L18Rik antikoerper, si:ch211-236k19.8 antikoerper, C5orf11 antikoerper, limb and CNS expressed 1 antikoerper, Lix1 antikoerper, LIX1 antikoerper, lix1 antikoerper
- Hintergrund
- The function of LIX1 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 32 kDa (MW of target protein)
-