TCTE1 Antikörper (Middle Region)

Produktnummer ABIN632172

Produktdetails anti-TCTE1 Antikörper

Target: TCTE1 (T-Complex-Associated-Testis-Expressed 1 (TCTE1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCTE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TCTE1 antibody was raised against the middle region of TCTE1

Aufreinigung: Affinity purified

Immunogen: TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCTE1 Blocking Peptide, catalog no. 33R-6244, is also available for use as a blocking control in assays to test for specificity of this TCTE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCTE1

Target: TCTE1 (T-Complex-Associated-Testis-Expressed 1 (TCTE1))

Andere Bezeichnung: TCTE1 (TCTE1 Produkte)

Synonyme: D17Sil1 antikoerper, Tcte-1 antikoerper, D6S46 antikoerper, t-complex-associated-testis-expressed 1 antikoerper, t-complex-associated testis expressed 1 antikoerper, TCTE1 antikoerper, Tcte1 antikoerper

Hintergrund: TCTE1 contains 7 LRR (leucine-rich) repeats. The exact function of TCTE1 remains unknown.

Molekulargewicht: 56 kDa (MW of target protein)