FBXO42 Antikörper (Middle Region)
-
- Target Alle FBXO42 Antikörper anzeigen
- FBXO42 (F-Box Protein 42 (FBXO42))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO42 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO42 antibody was raised against the middle region of FBXO42
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS
- Top Product
- Discover our top product FBXO42 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO42 Blocking Peptide, catalog no. 33R-8199, is also available for use as a blocking control in assays to test for specificity of this FBXO42 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO42 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO42 (F-Box Protein 42 (FBXO42))
- Andere Bezeichnung
- FBXO42 (FBXO42 Produkte)
- Synonyme
- Fbx42 antikoerper, JFK antikoerper, 6720460I06Rik antikoerper, mKIAA1332 antikoerper, zgc:64224 antikoerper, wu:fj14e08 antikoerper, MGC84191 antikoerper, FBXO42 antikoerper, F-box protein 42 antikoerper, F-box protein 42 L homeolog antikoerper, FBXO42 antikoerper, Fbxo42 antikoerper, fbxo42 antikoerper, fbxo42.L antikoerper
- Hintergrund
- Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Molekulargewicht
- 78 kDa (MW of target protein)
-