PRRC2B Antikörper (N-Term)

Produktnummer ABIN632176

Produktdetails anti-PRRC2B Antikörper

Target: PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRRC2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA0515 antibody was raised against the N terminal of KIAA0515

Aufreinigung: Affinity purified

Immunogen: KIAA0515 antibody was raised using the N terminal of KIAA0515 corresponding to a region with amino acids ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0515 Blocking Peptide, catalog no. 33R-1551, is also available for use as a blocking control in assays to test for specificity of this KIAA0515 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0515 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRRC2B

Target: PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))

Andere Bezeichnung: KIAA0515 (PRRC2B Produkte)

Synonyme: BAT2L antikoerper, BAT2L1 antikoerper, KIAA0515 antikoerper, LQFBS-1 antikoerper, 5830434P21Rik antikoerper, AI173903 antikoerper, Bat2l antikoerper, Bat2l1 antikoerper, D430039P21 antikoerper, mKIAA0515 antikoerper, proline rich coiled-coil 2B antikoerper, proline-rich coiled-coil 2B antikoerper, PRRC2B antikoerper, Prrc2b antikoerper

Hintergrund: The function of KIAA0515 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom