STK32A Antikörper (N-Term)

Produktnummer ABIN632177

Produktdetails anti-STK32A Antikörper

Target: STK32A (serine/threonine Kinase 32A (STK32A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STK32A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: STK32 A antibody was raised against the N terminal of STK32

Aufreinigung: Affinity purified

Immunogen: STK32 A antibody was raised using the N terminal of STK32 corresponding to a region with amino acids GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STK32A Blocking Peptide, catalog no. 33R-3165, is also available for use as a blocking control in assays to test for specificity of this STK32A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STK32A

Target: STK32A (serine/threonine Kinase 32A (STK32A))

Andere Bezeichnung: STK32A (STK32A Produkte)

Synonyme: YANK1 antikoerper, A930015B13Rik antikoerper, serine/threonine kinase 32A antikoerper, STK32A antikoerper, Stk32a antikoerper

Hintergrund: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.

Molekulargewicht: 20 kDa (MW of target protein)