ST14 Antikörper

Produktnummer ABIN632186

Produktdetails anti-ST14 Antikörper

Target: ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST14 Blocking Peptide, catalog no. 33R-8520, is also available for use as a blocking control in assays to test for specificity of this ST14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST14

Target: ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))

Andere Bezeichnung: ST14 (ST14 Produkte)

Synonyme: HAI antikoerper, MT-SP1 antikoerper, MTSP1 antikoerper, PRSS14 antikoerper, SNC19 antikoerper, TADG15 antikoerper, TMPRSS14 antikoerper, XMT-SP1 antikoerper, hai antikoerper, mt-sp1 antikoerper, mtsp1 antikoerper, prss14 antikoerper, snc19 antikoerper, st14 antikoerper, st14a antikoerper, tadg15 antikoerper, tmprss1 antikoerper, Epithin antikoerper, Prss14 antikoerper, Tmprss14 antikoerper, mCAP3 antikoerper, matriptase antikoerper, suppression of tumorigenicity 14 antikoerper, suppression of tumorigenicity 14 L homeolog antikoerper, suppression of tumorigenicity 14 (colon carcinoma) antikoerper, ST14 antikoerper, st14.L antikoerper, St14 antikoerper

Hintergrund: ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

Molekulargewicht: 46 kDa (MW of target protein)