ST14 Antikörper
-
- Target Alle ST14 Antikörper anzeigen
- ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ST14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT
- Top Product
- Discover our top product ST14 Primärantikörper
-
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (AA 11-100) antibody
ST14 Reaktivität: Human WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (AA 826-855), (C-Term) antibodyST14 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB2080 unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (Internal Region) antibodyST14 Reaktivität: Human, Maus WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (C-Term) antibodyST14 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Schwein, Kaninchen, Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (N-Term) antibodyST14 Reaktivität: Human WB, IF, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) antibodyST14 Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (AA 298-400) antibodyST14 Reaktivität: Human ELISA Wirt: Maus Monoclonal 2F4 unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (AA 10-59) antibodyST14 Reaktivität: Human WB, ELISA, IHC, IF, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (N-Term) antibodyST14 Reaktivität: Human WB, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14) (AA 566-855) antibodyST14 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ST14 Blocking Peptide, catalog no. 33R-8520, is also available for use as a blocking control in assays to test for specificity of this ST14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))
- Andere Bezeichnung
- ST14 (ST14 Produkte)
- Hintergrund
- ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
- Molekulargewicht
- 46 kDa (MW of target protein)
-
