FAM119A Antikörper (N-Term)

Produktnummer ABIN632190

Produktdetails anti-FAM119A Antikörper

Target: FAM119A (Family With Sequence Similarity 119A (FAM119A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM119A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM119 A antibody was raised against the N terminal of FAM119

Aufreinigung: Affinity purified

Immunogen: FAM119 A antibody was raised using the N terminal of FAM119 corresponding to a region with amino acids ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM119A Blocking Peptide, catalog no. 33R-1379, is also available for use as a blocking control in assays to test for specificity of this FAM119A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM119A

Target: FAM119A (Family With Sequence Similarity 119A (FAM119A))

Andere Bezeichnung: FAM119A (FAM119A Produkte)

Synonyme: 2310038H17Rik antikoerper, AI464204 antikoerper, Fam119a antikoerper, FAM119A antikoerper, HCA557b antikoerper, zgc:110528 antikoerper, RGD1311824 antikoerper, methyltransferase like 21A antikoerper, Mettl21a antikoerper, METTL21A antikoerper, mettl21a antikoerper

Hintergrund: FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.

Molekulargewicht: 24 kDa (MW of target protein)