MGC48628 (N-Term) Antikörper

Produktnummer ABIN632193

Produktdetails

Target: MGC48628

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGC48628 antibody was raised against the N terminal of MGC48628

Aufreinigung: Affinity purified

Immunogen: MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC48628 Blocking Peptide, catalog no. 33R-3746, is also available for use as a blocking control in assays to test for specificity of this MGC48628 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC48628 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: MGC48628

Hintergrund: The function of MGC48628 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 74 kDa (MW of target protein)