DPP3 Antikörper (N-Term)

Produktnummer ABIN632199

Produktdetails anti-DPP3 Antikörper

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPP3 antibody was raised against the N terminal of DPP3

Aufreinigung: Affinity purified

Immunogen: DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPP3 Blocking Peptide, catalog no. 33R-8738, is also available for use as a blocking control in assays to test for specificity of this DPP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPP3

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Andere Bezeichnung: DPP3 (DPP3 Produkte)

Synonyme: DPPIII antikoerper, dppiii antikoerper, MGC68828 antikoerper, dpp3 antikoerper, MGC79125 antikoerper, DKFZp469J1915 antikoerper, 4930533O14Rik antikoerper, C86324 antikoerper, CG7415 antikoerper, DPP antikoerper, DPP III antikoerper, Dmel\\CG7415 antikoerper, wu:fb64b04 antikoerper, zgc:86791 antikoerper, dipeptidyl peptidase 3 antikoerper, dipeptidylpeptidase 3 antikoerper, dipeptidyl-peptidase 3 S homeolog antikoerper, dipeptidyl-peptidase 3 L homeolog antikoerper, dipeptidyl-peptidase 3 antikoerper, Dipeptidyl aminopeptidase III antikoerper, DPP3 antikoerper, Dpp3 antikoerper, dpp3.S antikoerper, dpp3.L antikoerper, CpipJ_CPIJ005356 antikoerper, PTRG_00518 antikoerper, MCYG_01338 antikoerper, MGYG_01882 antikoerper, dpp3 antikoerper, DppIII antikoerper

Hintergrund: DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.

Molekulargewicht: 82 kDa (MW of target protein)