serine Dehydratase Antikörper (N-Term)
-
- Target Alle serine Dehydratase (SDS) Antikörper anzeigen
- serine Dehydratase (SDS)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser serine Dehydratase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SDS antibody was raised against the N terminal of SDS
- Aufreinigung
- Affinity purified
- Immunogen
- SDS antibody was raised using the N terminal of SDS corresponding to a region with amino acids AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA
- Top Product
- Discover our top product SDS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SDS Blocking Peptide, catalog no. 33R-1011, is also available for use as a blocking control in assays to test for specificity of this SDS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- serine Dehydratase (SDS)
- Andere Bezeichnung
- SDS (SDS Produkte)
- Hintergrund
- This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-