C11orf65 Antikörper (N-Term)
-
- Target Alle C11orf65 Produkte
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C11orf65 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C11 ORF65 antibody was raised against the N terminal Of C11 rf65
- Aufreinigung
- Affinity purified
- Immunogen
- C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C11ORF65 Blocking Peptide, catalog no. 33R-6312, is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
- Andere Bezeichnung
- C11ORF65 (C11orf65 Produkte)
- Synonyme
- AU017961 antikoerper, chromosome 11 open reading frame 65 antikoerper, chromosome 11 open reading frame 65 L homeolog antikoerper, chromosome 14 open reading frame, human C11orf65 antikoerper, RIKEN cDNA 4930550C14 gene antikoerper, similar to RIKEN cDNA 4930550C14 antikoerper, C11orf65 antikoerper, c11orf65.L antikoerper, C14H11orf65 antikoerper, 4930550C14Rik antikoerper, RGD1311251 antikoerper
- Hintergrund
- The specific function of C11orf65 is not yet known.
- Molekulargewicht
- 37 kDa (MW of target protein)
-