HAGH Antikörper (C-Term)

Produktnummer ABIN632208

Produktdetails anti-HAGH Antikörper

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAGH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAGH antibody was raised against the C terminal of HAGH

Aufreinigung: Affinity purified

Immunogen: HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAGH Blocking Peptide, catalog no. 33R-2847, is also available for use as a blocking control in assays to test for specificity of this HAGH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAGH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAGH

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Andere Bezeichnung: HAGH (HAGH Produkte)

Synonyme: glo-2 antikoerper, glo2 antikoerper, glx2 antikoerper, glxii antikoerper, hagh1 antikoerper, DDBDRAFT_0186675 antikoerper, DDBDRAFT_0230988 antikoerper, DDB_0186675 antikoerper, DDB_0230988 antikoerper, DDBDRAFT_0183924 antikoerper, DDBDRAFT_0230991 antikoerper, DDB_0183924 antikoerper, DDB_0230991 antikoerper, BC019817 antikoerper, Glo-2 antikoerper, Glo2 antikoerper, Rsp29 antikoerper, RSP29 antikoerper, fa66a03 antikoerper, wu:fa66a03 antikoerper, zgc:73161 antikoerper, GLO2 antikoerper, GLX2 antikoerper, GLXII antikoerper, HAGH1 antikoerper, hydroxyacylglutathione hydrolase L homeolog antikoerper, hydroxyacylglutathione hydrolase antikoerper, beta-lactamase domain-containing protein antikoerper, hydroxyacyl glutathione hydrolase antikoerper, hagh.L antikoerper, CND02510 antikoerper, gloB1 antikoerper, gloB2 antikoerper, Fbal_1466 antikoerper, Hagh antikoerper, hagh antikoerper, HAGH antikoerper

Hintergrund: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Molekulargewicht: 29 kDa (MW of target protein)