C12ORF24 Antikörper (N-Term)
-
- Target Alle C12ORF24 (C12orf24) Produkte
- C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C12ORF24 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C12 ORF24 antibody was raised against the N terminal Of C12 rf24
- Aufreinigung
- Affinity purified
- Immunogen
- C12 ORF24 antibody was raised using the N terminal Of C12 rf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C12ORF24 Blocking Peptide, catalog no. 33R-1583, is also available for use as a blocking control in assays to test for specificity of this C12ORF24 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))
- Andere Bezeichnung
- C12ORF24 (C12orf24 Produkte)
- Synonyme
- C12orf24 antikoerper, C17H12orf24 antikoerper, HSU79274 antikoerper, 1500011H22Rik antikoerper, family with sequence similarity 216 member A antikoerper, family with sequence similarity 216, member A antikoerper, FAM216A antikoerper, Fam216a antikoerper
- Hintergrund
- The function of C12orf24 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 31 kDa (MW of target protein)
-