CAMKV Antikörper (N-Term)

Produktnummer ABIN632211

Produktdetails anti-CAMKV Antikörper

Target: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAMKV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CAMKV antibody was raised against the N terminal of CAMKV

Aufreinigung: Affinity purified

Immunogen: CAMKV antibody was raised using the N terminal of CAMKV corresponding to a region with amino acids NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAMKV Blocking Peptide, catalog no. 33R-6867, is also available for use as a blocking control in assays to test for specificity of this CAMKV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKV antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAMKV

Target: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Andere Bezeichnung: CAMKV (CAMKV Produkte)

Synonyme: camkv antikoerper, zgc:63506 antikoerper, CAMKV antikoerper, 1G5 antikoerper, VACAMKL antikoerper, BB074618 antikoerper, BC017634 antikoerper, CaM kinase-like vesicle-associated b antikoerper, CaM kinase like vesicle associated antikoerper, CaM kinase-like vesicle-associated antikoerper, camkvb antikoerper, CAMKV antikoerper, camkv antikoerper, Camkv antikoerper

Hintergrund: CAMKV does not appear to have detectable kinase activity.

Molekulargewicht: 55 kDa (MW of target protein)