HORMAD2 Antikörper (N-Term)
-
- Target Alle HORMAD2 Antikörper anzeigen
- HORMAD2 (HORMA Domain Containing 2 (HORMAD2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HORMAD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HORMAD2 antibody was raised against the N terminal of HORMAD2
- Aufreinigung
- Affinity purified
- Immunogen
- HORMAD2 antibody was raised using the N terminal of HORMAD2 corresponding to a region with amino acids VKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHII
- Top Product
- Discover our top product HORMAD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HORMAD2 Blocking Peptide, catalog no. 33R-9626, is also available for use as a blocking control in assays to test for specificity of this HORMAD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HORMAD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HORMAD2 (HORMA Domain Containing 2 (HORMAD2))
- Andere Bezeichnung
- HORMAD2 (HORMAD2 Produkte)
- Hintergrund
- The function of HORMAD protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 35 kDa (MW of target protein)
-