GFPT2 Antikörper (Middle Region)

Produktnummer ABIN632223

Produktdetails anti-GFPT2 Antikörper

Target: GFPT2 (Glutamine-Fructose-6-Phosphate Transaminase 2 (GFPT2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GFPT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GFPT2 antibody was raised against the middle region of GFPT2

Aufreinigung: Affinity purified

Immunogen: GFPT2 antibody was raised using the middle region of GFPT2 corresponding to a region with amino acids TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GFPT2 Blocking Peptide, catalog no. 33R-8983, is also available for use as a blocking control in assays to test for specificity of this GFPT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFPT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GFPT2

Target: GFPT2 (Glutamine-Fructose-6-Phosphate Transaminase 2 (GFPT2))

Andere Bezeichnung: GFPT2 (GFPT2 Produkte)

Synonyme: gfpt1 antikoerper, AI480523 antikoerper, GFAT2 antikoerper, glutamine-fructose-6-phosphate transaminase 2 L homeolog antikoerper, glutamine-fructose-6-phosphate transaminase 2 antikoerper, glutamine fructose-6-phosphate transaminase 2 antikoerper, gfpt2.L antikoerper, GFPT2 antikoerper, gfpt2 antikoerper, Gfpt2 antikoerper

Hintergrund: GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.

Molekulargewicht: 77 kDa (MW of target protein)