GK2 Antikörper (C-Term)
-
- Target Alle GK2 Antikörper anzeigen
- GK2 (Glycerol Kinase 2 (GK2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GK2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GK2 antibody was raised against the C terminal of GK2
- Aufreinigung
- Affinity purified
- Immunogen
- GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS
- Top Product
- Discover our top product GK2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GK2 Blocking Peptide, catalog no. 33R-7592, is also available for use as a blocking control in assays to test for specificity of this GK2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GK2 (Glycerol Kinase 2 (GK2))
- Andere Bezeichnung
- GK2 (GK2 Produkte)
- Synonyme
- GKP2 antikoerper, GKTA antikoerper, Gk-rs2 antikoerper, N(alpha)-acetyltransferase 11, NatA catalytic subunit antikoerper, glycerol kinase 2 antikoerper, glycerol kinase antikoerper, NAA11 antikoerper, GK2 antikoerper, PPA_RS11645 antikoerper, ATEG_05802 antikoerper, AGROH133_15068 antikoerper, Gk2 antikoerper
- Hintergrund
- GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.
- Molekulargewicht
- 61 kDa (MW of target protein)
-