SH3BP4 Antikörper (N-Term)
-
- Target Alle SH3BP4 Antikörper anzeigen
- SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SH3BP4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SH3 BP4 antibody was raised against the N terminal of SH3 P4
- Aufreinigung
- Affinity purified
- Immunogen
- SH3 BP4 antibody was raised using the N terminal of SH3 P4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
- Top Product
- Discover our top product SH3BP4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SH3BP4 Blocking Peptide, catalog no. 33R-3104, is also available for use as a blocking control in assays to test for specificity of this SH3BP4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))
- Andere Bezeichnung
- SH3BP4 (SH3BP4 Produkte)
- Hintergrund
- This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.
- Molekulargewicht
- 107 kDa (MW of target protein)
-