SH3BP4 Antikörper (N-Term)

Produktnummer ABIN632230

Produktdetails anti-SH3BP4 Antikörper

Target: SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3BP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SH3 BP4 antibody was raised against the N terminal of SH3 P4

Aufreinigung: Affinity purified

Immunogen: SH3 BP4 antibody was raised using the N terminal of SH3 P4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3BP4 Blocking Peptide, catalog no. 33R-3104, is also available for use as a blocking control in assays to test for specificity of this SH3BP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3BP4

Target: SH3BP4 (SH3-Domain Binding Protein 4 (SH3BP4))

Andere Bezeichnung: SH3BP4 (SH3BP4 Produkte)

Synonyme: BOG25 antikoerper, TTP antikoerper, AI594717 antikoerper, AW227605 antikoerper, SH3BP4 antikoerper, bog25 antikoerper, ttp antikoerper, LOC569399 antikoerper, sh3bp4 antikoerper, SH3 domain binding protein 4 antikoerper, SH3-domain binding protein 4 antikoerper, SH3-domain binding protein 4 L homeolog antikoerper, SH3BP4 antikoerper, Sh3bp4 antikoerper, sh3bp4 antikoerper, sh3bp4.L antikoerper

Hintergrund: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Molekulargewicht: 107 kDa (MW of target protein)