FAM53C Antikörper (N-Term)

Produktnummer ABIN632235

Produktdetails anti-FAM53C Antikörper

Target: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM53C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM53 C antibody was raised against the N terminal of FAM53

Aufreinigung: Affinity purified

Immunogen: FAM53 C antibody was raised using the N terminal of FAM53 corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM53C Blocking Peptide, catalog no. 33R-8648, is also available for use as a blocking control in assays to test for specificity of this FAM53C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM53C

Target: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Andere Bezeichnung: FAM53C (FAM53C Produkte)

Synonyme: C5orf6 antikoerper, 2810012G03Rik antikoerper, family with sequence similarity 53 member C antikoerper, family with sequence similarity 53, member C antikoerper, FAM53C antikoerper, Fam53c antikoerper

Hintergrund: The function of FAM53 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 43 kDa (MW of target protein)