MAP4K1 Antikörper (N-Term)

Produktnummer ABIN632239

Produktdetails anti-MAP4K1 Antikörper

Target: MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP4K1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP4 K1 antibody was raised against the N terminal of MAP4 1

Aufreinigung: Affinity purified

Immunogen: MAP4 K1 antibody was raised using the N terminal of MAP4 1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP4K1 Blocking Peptide, catalog no. 33R-9582, is also available for use as a blocking control in assays to test for specificity of this MAP4K1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP4K1

Target: MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))

Andere Bezeichnung: MAP4K1 (MAP4K1 Produkte)

Synonyme: HPK1 antikoerper, Hpk1 antikoerper, mHPK1 antikoerper, mitogen activated protein kinase kinase kinase kinase 1 antikoerper, mitogen-activated protein kinase kinase kinase kinase 1 antikoerper, Map4k1 antikoerper, MAP4K1 antikoerper

Hintergrund: MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Signaling of Hepatocyte Growth Factor Receptor