TRIB1 Antikörper
-
- Target Alle TRIB1 Antikörper anzeigen
- TRIB1 (Tribbles Homolog 1 (TRIB1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
- Top Product
- Discover our top product TRIB1 Primärantikörper
-
anti-Tribbles Homolog 1 (TRIB1) (AA 91-191) antibody
TRIB1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4A10 unconjugated
anti-Tribbles Homolog 1 (TRIB1) (AA 341-370), (C-Term) antibodyTRIB1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB9762 unconjugated
anti-Tribbles Homolog 1 (TRIB1) (AA 3-91) antibodyTRIB1 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 1 (TRIB1) (AA 91-191) antibodyTRIB1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Tribbles Homolog 1 (TRIB1) (AA 203-372) antibodyTRIB1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 1 (TRIB1) (C-Term) antibodyVerified TRIB1 Reaktivität: Human ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-Tribbles Homolog 1 (TRIB1) (Internal Region) antibodyVerified TRIB1 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Tribbles Homolog 1 (TRIB1) (AA 215-264) antibodyTRIB1 Reaktivität: Human, Maus, Rind (Kuh), Ratte, Pferd, Meerschweinchen, Affe, Kaninchen, Fledermaus, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 1 (TRIB1) (C-Term) antibodyTRIB1 Reaktivität: Human, Maus, Rind (Kuh), Pferd, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 1 (TRIB1) (C-Term) antibodyTRIB1 Reaktivität: Human, Maus, Rind (Kuh), Ratte, Pferd, Meerschweinchen, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIB1 Blocking Peptide, catalog no. 33R-9035, is also available for use as a blocking control in assays to test for specificity of this TRIB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIB1 (Tribbles Homolog 1 (TRIB1))
- Andere Bezeichnung
- TRIB1 (TRIB1 Produkte)
- Synonyme
- TRIB1 antikoerper, c8fw antikoerper, gig2 antikoerper, skip1 antikoerper, trb1 antikoerper, tribbles antikoerper, C8FW antikoerper, GIG2 antikoerper, SKIP1 antikoerper, TRB1 antikoerper, A530090O15Rik antikoerper, TRB-1 antikoerper, Trb1 antikoerper, Gig2 antikoerper, tribbles pseudokinase 1 antikoerper, tribbles pseudokinase 1 L homeolog antikoerper, tribbles homolog 1 (Drosophila) antikoerper, TRIB1 antikoerper, trib1 antikoerper, trib1.L antikoerper, Trib1 antikoerper
- Hintergrund
- TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration
-
