PEX7 Antikörper (N-Term)
-
- Target Alle PEX7 Antikörper anzeigen
- PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Maus, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEX7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PEX7 antibody was raised against the N terminal of PEX7
- Aufreinigung
- Affinity purified
- Immunogen
- PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI
- Top Product
- Discover our top product PEX7 Primärantikörper
-
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (AA 1-240) antibody
PEX7 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (AA 2-99) antibodyPEX7 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (C-Term) antibodyPEX7 Reaktivität: Maus, Human, Ratte WB, ELISA, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (Internal Region) antibodyPEX7 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (Internal Region) antibodyPEX7 Reaktivität: Maus, Human, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (AA 61-160) antibodyPEX7 Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (N-Term) antibodyPEX7 Reaktivität: Maus, Human, Rind (Kuh), Kaninchen, Hund, Zebrafisch (Danio rerio), Meerschweinchen, Affe, Fledermaus, Schwein, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (AA 204-253) antibodyPEX7 Reaktivität: Maus, Human, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (N-Term) antibodyPEX7 Reaktivität: Maus, Human, Ratte, Rind (Kuh), Kaninchen, Hund, Zebrafisch (Danio rerio), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 7 (PEX7) (Internal Region) antibodyPEX7 Reaktivität: Maus, Human, Ratte WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEX7 Blocking Peptide, catalog no. 33R-6402, is also available for use as a blocking control in assays to test for specificity of this PEX7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))
- Andere Bezeichnung
- PEX7 (PEX7 Produkte)
- Synonyme
- PEX7 antikoerper, pex7 antikoerper, DDBDRAFT_0206295 antikoerper, DDBDRAFT_0233068 antikoerper, DDB_0206295 antikoerper, DDB_0233068 antikoerper, MmPEX7 antikoerper, PBD9B antikoerper, PTS2R antikoerper, RCDP1 antikoerper, RD antikoerper, zgc:103552 antikoerper, Peroxin-7 antikoerper, peroxisomal biogenesis factor 7 antikoerper, WD40 repeat-containing protein antikoerper, PEX7 antikoerper, pex7 antikoerper, Pex7 antikoerper
- Hintergrund
- PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-
