PRKY Antikörper (N-Term)

Produktnummer ABIN632264

Produktdetails anti-PRKY Antikörper

Target: PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKY antibody was raised against the N terminal of PRKY

Aufreinigung: Affinity purified

Immunogen: PRKY antibody was raised using the N terminal of PRKY corresponding to a region with amino acids MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKY Blocking Peptide, catalog no. 33R-5895, is also available for use as a blocking control in assays to test for specificity of this PRKY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKY

Target: PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))

Andere Bezeichnung: PRKY (PRKY Produkte)

Synonyme: PRKXP3 antikoerper, PRKYP antikoerper, protein kinase, Y-linked, pseudogene antikoerper, PRKY antikoerper

Hintergrund: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome.

Molekulargewicht: 32 kDa (MW of target protein)